Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries) |
Domain d6i0zb4: 6i0z B:383-493 [365352] automated match to d1dfca4 complexed with gzq |
PDB Entry: 6i0z (more details), 1.77 Å
SCOPe Domain Sequences for d6i0zb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i0zb4 b.42.5.1 (B:383-493) Fascin {Human (Homo sapiens) [TaxId: 9606]} rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey
Timeline for d6i0zb4:
View in 3D Domains from other chains: (mouse over for more information) d6i0za1, d6i0za2, d6i0za3, d6i0za4 |