Lineage for d6i0zb3 (6i0z B:260-382)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385822Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2385823Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. 2385824Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. 2385825Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries)
  8. 3065289Domain d6i0zb3: 6i0z B:260-382 [365351]
    automated match to d1dfca3
    complexed with gzq

Details for d6i0zb3

PDB Entry: 6i0z (more details), 1.77 Å

PDB Description: crystal structure of fascin in complex with compound 1
PDB Compounds: (B:) fascin

SCOPe Domain Sequences for d6i0zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i0zb3 b.42.5.1 (B:260-382) Fascin {Human (Homo sapiens) [TaxId: 9606]}
caqvvlqaanernvstrqgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtlta
tggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmk
lin

SCOPe Domain Coordinates for d6i0zb3:

Click to download the PDB-style file with coordinates for d6i0zb3.
(The format of our PDB-style files is described here.)

Timeline for d6i0zb3:

  • d6i0zb3 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28