Lineage for d6gall_ (6gal L:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573426Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2573427Protein automated matches [191173] (13 species)
    not a true protein
  7. 2573460Species Escherichia coli [TaxId:83333] [330666] (13 PDB entries)
  8. 3065272Domain d6gall_: 6gal L: [365334]
    Other proteins in same PDB: d6gals_, d6galt_
    automated match to d5lmml_
    complexed with cl, cxs, ej2, f3s, li, mg, sf3, sf4, so4

Details for d6gall_

PDB Entry: 6gal (more details), 1.25 Å

PDB Description: structure of fully reduced hydrogenase (hyd-1) variant e28q collected at ph 10
PDB Compounds: (L:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d6gall_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gall_ e.18.1.0 (L:) automated matches {Escherichia coli [TaxId: 83333]}
stqyetqgytinnagrrlvvdpitriqghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d6gall_:

Click to download the PDB-style file with coordinates for d6gall_.
(The format of our PDB-style files is described here.)

Timeline for d6gall_:

  • d6gall_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28