Lineage for d6gesa_ (6ges A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (697 PDB entries)
  8. 3065259Domain d6gesa_: 6ges A: [365321]
    automated match to d1erka_
    complexed with 6h3, edo, ewh, so4

Details for d6gesa_

PDB Entry: 6ges (more details), 2.07 Å

PDB Description: crystal structure of erk1 covalently bound to sm1-71
PDB Compounds: (A:) Mitogen-activated protein kinase 3

SCOPe Domain Sequences for d6gesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gesa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgevemvkgqpfdvgprytqlqyigegaygmvssaydhvrktrvaikkispfehqtycqr
tlreiqillrfrhenvigirdilrastleamrdvyivqdlmetdlykllksqqlsndhic
yflyqilrglkyihsanvlhrdlkpsnllinttcdlkicdfglariadpehdhtgfltey
vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
sqedlnciinmkarnylqslpsktkvawaklfpksdskaldlldrmltfnpnkritveea
lahpyleqyydptdepvaeepftfamelddlpkerlkelifqetarfqpg

SCOPe Domain Coordinates for d6gesa_:

Click to download the PDB-style file with coordinates for d6gesa_.
(The format of our PDB-style files is described here.)

Timeline for d6gesa_:

  • d6gesa_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28