SCOPe 2.08: Domain d6ghmc1: 6ghm C:920-1055

Lineage for d6ghmc1 (6ghm C:920-1055)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)

8. Domain d6ghmc1: 6ghm C:920-1055 [365319]
   Other proteins in same PDB: d6ghmc2, d6ghmd2
   automated match to d4a63d1
   complexed with edo, gol, mn, nhe

Details for d6ghmc1

PDB Entry: 6ghm, 2.15 Å

PDB Description: structure of pp1 alpha phosphatase bound to aspp2

PDB Compounds: (C:) apoptosis-stimulating of p53 protein 2

SCOPe Domain Sequences for d6ghmc1:

Sequence; same for both SEQRES and ATOM records:

>d6ghmc1 d.211.1.1 (C:920-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv
qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg
ytqcsqflygvqekmg

Timeline for d6ghmc1:

• d6ghmc1 first appeared in SCOPe 2.07