Lineage for d6ghmc1 (6ghm C:920-1055)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006640Domain d6ghmc1: 6ghm C:920-1055 [365319]
    Other proteins in same PDB: d6ghmc2, d6ghmd2
    automated match to d4a63d1
    complexed with edo, gol, mn, nhe

Details for d6ghmc1

PDB Entry: 6ghm (more details), 2.15 Å

PDB Description: structure of pp1 alpha phosphatase bound to aspp2
PDB Compounds: (C:) apoptosis-stimulating of p53 protein 2

SCOPe Domain Sequences for d6ghmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghmc1 d.211.1.1 (C:920-1055) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvkfnplallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflv
qfgvnvnaadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeeg
ytqcsqflygvqekmg

SCOPe Domain Coordinates for d6ghmc1:

Click to download the PDB-style file with coordinates for d6ghmc1.
(The format of our PDB-style files is described here.)

Timeline for d6ghmc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ghmc2