Lineage for d6dpxa_ (6dpx A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2568487Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2568529Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (105 PDB entries)
  8. 3065250Domain d6dpxa_: 6dpx A: [365312]
    automated match to d1my8a_
    complexed with h7g

Details for d6dpxa_

PDB Entry: 6dpx (more details), 1.9 Å

PDB Description: x-ray crystal structure of ampc beta-lactamase with inhibitor
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6dpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dpxa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d6dpxa_:

Click to download the PDB-style file with coordinates for d6dpxa_.
(The format of our PDB-style files is described here.)

Timeline for d6dpxa_:

  • d6dpxa_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28