Lineage for d6hhpa1 (6hhp A:1-231)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333684Protein automated matches [190238] (9 species)
    not a true protein
  7. 2333696Species Human (Homo sapiens) [TaxId:9606] [187008] (44 PDB entries)
  8. 3065243Domain d6hhpa1: 6hhp A:1-231 [365305]
    Other proteins in same PDB: d6hhpa2
    automated match to d2o98a_
    complexed with g4z, mg; mutant

Details for d6hhpa1

PDB Entry: 6hhp (more details), 1.8 Å

PDB Description: ternary complex of estrogen receptor alpha peptide and 14-3-3 sigma c42 mutant bound to disulfide fragment ppi stabilizer 1
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d6hhpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hhpa1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsneercllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d6hhpa1:

Click to download the PDB-style file with coordinates for d6hhpa1.
(The format of our PDB-style files is described here.)

Timeline for d6hhpa1:

  • d6hhpa1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28