Lineage for d6fpwt_ (6fpw T:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573496Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2573497Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2573645Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2573646Protein automated matches [191172] (11 species)
    not a true protein
  7. 3051140Species Escherichia coli [TaxId:83333] [351202] (8 PDB entries)
  8. 3065221Domain d6fpwt_: 6fpw T: [365283]
    Other proteins in same PDB: d6fpwl_, d6fpwm_
    automated match to d3rgws_
    complexed with cl, ej2, f3s, lmt, mg, sf3, sf4, so4

Details for d6fpwt_

PDB Entry: 6fpw (more details), 1.35 Å

PDB Description: structure of fully reduced hydrogenase (hyd-1)
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d6fpwt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fpwt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d6fpwt_:

Click to download the PDB-style file with coordinates for d6fpwt_.
(The format of our PDB-style files is described here.)

Timeline for d6fpwt_:

  • d6fpwt_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28