Lineage for d6g7rt_ (6g7r T:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573496Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2573497Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2573645Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2573646Protein automated matches [191172] (11 species)
    not a true protein
  7. 3051140Species Escherichia coli [TaxId:83333] [351202] (8 PDB entries)
  8. 3065215Domain d6g7rt_: 6g7r T: [365277]
    Other proteins in same PDB: d6g7rl_, d6g7rm_
    automated match to d3rgws_
    complexed with cl, ej2, f3s, lmt, mg, sf3, sf4, so4

Details for d6g7rt_

PDB Entry: 6g7r (more details), 1.2 Å

PDB Description: structure of fully reduced variant e28q of e. coli hydrogenase-1 at ph 8
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d6g7rt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g7rt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 83333]}
pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii
tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa
rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq
rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq
sghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d6g7rt_:

Click to download the PDB-style file with coordinates for d6g7rt_.
(The format of our PDB-style files is described here.)

Timeline for d6g7rt_:

  • d6g7rt_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28