Lineage for d6gpua1 (6gpu A:1-106)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2534917Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 2534936Protein automated matches [190943] (2 species)
    not a true protein
  7. 2534943Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (12 PDB entries)
  8. 3065208Domain d6gpua1: 6gpu A:1-106 [365270]
    Other proteins in same PDB: d6gpua2
    automated match to d4eesa_
    complexed with cl, co, fmn, mg, trs

Details for d6gpua1

PDB Entry: 6gpu (more details), 1.17 Å

PDB Description: crystal structure of minisog at 1.17a resolution
PDB Compounds: (A:) Phototropin-2

SCOPe Domain Sequences for d6gpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gpua1 d.110.3.6 (A:1-106) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meksfvitdprlpdnpiifasdgflelteysreeilgrngrflqgpetdqatvqkirdai
rdqreitvqlinytksgkkfwnllhlqpmrdqkgelqyfigvqldg

SCOPe Domain Coordinates for d6gpua1:

Click to download the PDB-style file with coordinates for d6gpua1.
(The format of our PDB-style files is described here.)

Timeline for d6gpua1:

  • d6gpua1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6gpua2