Lineage for d6f9oa1 (6f9o A:1-303)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (108 species)
    not a true protein
  7. 3065201Species Psychrobacter cryohalolentis [TaxId:335284] [365263] (1 PDB entry)
  8. 3065202Domain d6f9oa1: 6f9o A:1-303 [365264]
    Other proteins in same PDB: d6f9oa2
    automated match to d4mj3b_
    complexed with cl, na, peg

Details for d6f9oa1

PDB Entry: 6f9o (more details), 1.05 Å

PDB Description: crystal structure of cold-adapted haloalkane dehalogenase dpca from psychrobacter cryohalolentis k5
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d6f9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f9oa1 c.69.1.0 (A:1-303) automated matches {Psychrobacter cryohalolentis [TaxId: 335284]}
mkilrtpdsrfanlpdynfdphylmvddsedselrvhyldegprdadpvlllhgepswcy
lyrkmipiltaaghrviapdlpgfgrsdkpasrtdytyqrhvnwmqsvldqldlnnitlf
cqdwggliglrlvaenpdrfarvaagntmlptgdhdlgegfrkwqqfsqeipqfhvggti
ksgtvtklsqavidaynapfpdesykegarqfpllvpstpddpasennraawielskwtk
pfitlfsdsdpvtaggdrimqkiipgtkgqahttiangghflqedqgekvakllvqfihd
npr

SCOPe Domain Coordinates for d6f9oa1:

Click to download the PDB-style file with coordinates for d6f9oa1.
(The format of our PDB-style files is described here.)

Timeline for d6f9oa1:

  • d6f9oa1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6f9oa2