Lineage for d6d3ea1 (6d3e A:207-476)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335636Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2335637Species Human (Homo sapiens) [TaxId:9606] [48525] (141 PDB entries)
    Uniprot P37231 232-505
  8. 3065184Domain d6d3ea1: 6d3e A:207-476 [365246]
    Other proteins in same PDB: d6d3ea2, d6d3eb2
    automated match to d2q5sb_
    complexed with ft7

Details for d6d3ea1

PDB Entry: 6d3e (more details), 2.4 Å

PDB Description: pparg lbd in complex with sr1988
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6d3ea1:

Sequence, based on SEQRES records: (download)

>d6d3ea1 a.123.1.1 (A:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d6d3ea1 a.123.1.1 (A:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkiqske
vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
kktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d6d3ea1:

Click to download the PDB-style file with coordinates for d6d3ea1.
(The format of our PDB-style files is described here.)

Timeline for d6d3ea1:

  • d6d3ea1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6d3ea2