Lineage for d6a7ua1 (6a7u A:36-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311120Family a.22.1.0: automated matches [238448] (1 protein)
    not a true family
  6. 2311121Protein automated matches [238450] (2 species)
    not a true protein
  7. 2311122Species Human (Homo sapiens) [TaxId:9606] [238452] (6 PDB entries)
  8. 3065180Domain d6a7ua1: 6a7u A:36-124 [365242]
    automated match to d4m6ba1

Details for d6a7ua1

PDB Entry: 6a7u (more details), 2.6 Å

PDB Description: crystal structure of histone h2a.bbd-h2b dimer
PDB Compounds: (A:) Histone H2B type 2-E,Histone H2A-Bbd type 2/3

SCOPe Domain Sequences for d6a7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a7ua1 a.22.1.0 (A:36-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkytss

SCOPe Domain Coordinates for d6a7ua1:

Click to download the PDB-style file with coordinates for d6a7ua1.
(The format of our PDB-style files is described here.)

Timeline for d6a7ua1:

  • d6a7ua1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6a7ua2