Lineage for d6aida_ (6aid A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2475442Family c.69.1.16: Lipase [53555] (2 proteins)
  6. 2475447Protein automated matches [254730] (4 species)
    not a true protein
  7. 2475452Species Thermobifida alba [TaxId:53522] [256136] (3 PDB entries)
  8. 3065179Domain d6aida_: 6aid A: [365241]
    automated match to d3visa_
    complexed with 9yl, ca, lac, na

Details for d6aida_

PDB Entry: 6aid (more details), 1.3 Å

PDB Description: structural insights into the unique polylactate degrading mechanism of thermobifida alba cutinase
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d6aida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aida_ c.69.1.16 (A:) automated matches {Thermobifida alba [TaxId: 53522]}
anpyergpnptesmlearsgpfsvseerasrfgadgfgggtiyyprenntygaiaispgy
tgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaaldymltdassavrnrid
asrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrditvptliigaeydtias
vtlhskpfynsipsptdkayleldgashfapnitnktigmysvawlkrfvdedtrytqfl
cpgprtgllsdveeyrstcpf

SCOPe Domain Coordinates for d6aida_:

Click to download the PDB-style file with coordinates for d6aida_.
(The format of our PDB-style files is described here.)

Timeline for d6aida_:

  • d6aida_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28