Lineage for d6cgqb_ (6cgq B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2481051Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2481052Protein automated matches [190215] (34 species)
    not a true protein
  7. 3065177Species Bacillus subtilis [TaxId:96241] [365239] (2 PDB entries)
  8. 3065178Domain d6cgqb_: 6cgq B: [365240]
    automated match to d2zsja_
    complexed with f0g, plp, po4

Details for d6cgqb_

PDB Entry: 6cgq (more details), 2.02 Å

PDB Description: threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala
PDB Compounds: (B:) threonine synthase

SCOPe Domain Sequences for d6cgqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cgqb_ c.79.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 96241]}
wkglihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsfkdr
gmvmavakakeegndtimcastgntsaaaaayaaranmkciviipngkiafgklaqavmy
gaeiiaidgnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapdvla
ipvgnagnisaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatairig
npaswdkavkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqvksg
eipkgskvvavltgnglkdpntavdiseikpvtlptnedsileyv

SCOPe Domain Coordinates for d6cgqb_:

Click to download the PDB-style file with coordinates for d6cgqb_.
(The format of our PDB-style files is described here.)

Timeline for d6cgqb_:

  • d6cgqb_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28