Lineage for d6atea_ (6ate A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542545Protein c-src tyrosine kinase [56155] (3 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542546Species Chicken (Gallus gallus) [TaxId:9031] [56157] (50 PDB entries)
  8. 3065175Domain d6atea_: 6ate A: [365237]
    automated match to d3f6xa_
    complexed with 6h3

Details for d6atea_

PDB Entry: 6ate (more details), 2.4 Å

PDB Description: src kinase bound to covalent inhibitor
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d6atea_:

Sequence, based on SEQRES records: (download)

>d6atea_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkepeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d6atea_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlpeafeaqvmkklrheklvq
lyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyvh
rdlraanilvgenlvckvadfglarlpikwtapeaalygrftiksdvwsfgilltelttk
grvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerptfeylqafled
yftstepqyqpgenl

SCOPe Domain Coordinates for d6atea_:

Click to download the PDB-style file with coordinates for d6atea_.
(The format of our PDB-style files is described here.)

Timeline for d6atea_:

  • d6atea_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-28