Lineage for d6ienc_ (6ien C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337479Species Mycobacterium tuberculosis [TaxId:83332] [225923] (9 PDB entries)
  8. 3065174Domain d6ienc_: 6ien C: [365236]
    automated match to d1tj7a_
    complexed with arg, as1, edo, fum, peg

Details for d6ienc_

PDB Entry: 6ien (more details), 2.7 Å

PDB Description: substrate/product bound argininosuccinate lyase from mycobacterium tuberculosis
PDB Compounds: (C:) Argininosuccinate Lyase

SCOPe Domain Sequences for d6ienc_:

Sequence, based on SEQRES records: (download)

>d6ienc_ a.127.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
ewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsv
sardcrggtapgrvaeqlnaigeaaerlrrqlvr

Sequence, based on observed residues (ATOM records): (download)

>d6ienc_ a.127.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
ewlvrqgvpfrsahrevltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr

SCOPe Domain Coordinates for d6ienc_:

Click to download the PDB-style file with coordinates for d6ienc_.
(The format of our PDB-style files is described here.)

Timeline for d6ienc_:

  • d6ienc_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21