Lineage for d6iemb_ (6iem B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337479Species Mycobacterium tuberculosis [TaxId:83332] [225923] (9 PDB entries)
  8. 3065169Domain d6iemb_: 6iem B: [365231]
    automated match to d1tj7a_
    complexed with 2pe, edo, gol, p3g, pg4, pge

Details for d6iemb_

PDB Entry: 6iem (more details), 2.2 Å

PDB Description: argininosuccinate lyase from mycobacterium tuberculosis
PDB Compounds: (B:) Argininosuccinate Lyase

SCOPe Domain Sequences for d6iemb_:

Sequence, based on SEQRES records: (download)

>d6iemb_ a.127.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
slwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllag
ldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwl
rdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdld
rivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafv
famiavdlsrlaediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlig
nlagllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelap
agytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqv
revltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr

Sequence, based on observed residues (ATOM records): (download)

>d6iemb_ a.127.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
slwggrfaggpsdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllag
ldslaqdvadgsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwl
rdavrrvatgvldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdld
rivdfdkraavspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafv
famiavdlsrlaediivwsstefgyvtlhdswstgimpqkknpdiaelargksgrlignl
agllatlkaqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapag
ytlatdlaewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvre
vltiegsvsardcrggtapgrvaeqlnaigeaaerlrrqlvr

SCOPe Domain Coordinates for d6iemb_:

Click to download the PDB-style file with coordinates for d6iemb_.
(The format of our PDB-style files is described here.)

Timeline for d6iemb_:

  • d6iemb_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21