Lineage for d6mhba2 (6mhb A:103-241)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2322207Protein Class omega GST [81352] (1 species)
  7. 2322208Species Human (Homo sapiens) [TaxId:9606] [47632] (14 PDB entries)
  8. 3065167Domain d6mhba2: 6mhb A:103-241 [365229]
    Other proteins in same PDB: d6mhba1, d6mhbb1, d6mhbc1, d6mhbd1, d6mhbe1, d6mhbf1
    automated match to d1eema1
    complexed with jr7, mes

Details for d6mhba2

PDB Entry: 6mhb (more details), 2.75 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor 18
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d6mhba2:

Sequence, based on SEQRES records: (download)

>d6mhba2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

Sequence, based on observed residues (ATOM records): (download)

>d6mhba2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirkedyaglkeefrkeftkleevltnkkttff
ggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdwqgf
lelylqnspeacdygl

SCOPe Domain Coordinates for d6mhba2:

Click to download the PDB-style file with coordinates for d6mhba2.
(The format of our PDB-style files is described here.)

Timeline for d6mhba2:

  • d6mhba2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-21