Lineage for d6mhba1 (6mhb A:6-102)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455762Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2456073Protein Class omega GST [81363] (1 species)
  7. 2456074Species Human (Homo sapiens) [TaxId:9606] [52877] (14 PDB entries)
  8. 3065166Domain d6mhba1: 6mhb A:6-102 [365228]
    Other proteins in same PDB: d6mhba2, d6mhbb2, d6mhbc2, d6mhbd2, d6mhbe2, d6mhbf2
    automated match to d1eema2
    complexed with jr7, mes

Details for d6mhba1

PDB Entry: 6mhb (more details), 2.75 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor 18
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d6mhba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mhba1 c.47.1.5 (A:6-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
arslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewffk
knpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d6mhba1:

Click to download the PDB-style file with coordinates for d6mhba1.
(The format of our PDB-style files is described here.)

Timeline for d6mhba1:

  • d6mhba1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-21