Lineage for d5zc7b_ (5zc7 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467648Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2467649Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2468152Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2468153Protein automated matches [190891] (36 species)
    not a true protein
  7. 2468410Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (6 PDB entries)
  8. 3065161Domain d5zc7b_: 5zc7 B: [365223]
    automated match to d4mb6a_
    complexed with act, ade, cl, na, ni

Details for d5zc7b_

PDB Entry: 5zc7 (more details), 2 Å

PDB Description: crystal structure of aprt from y. pseudotuberculosis with bound adenine (p63 space group).
PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5zc7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zc7b_ c.61.1.0 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
ktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvg
teargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkv
lvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg
h

SCOPe Domain Coordinates for d5zc7b_:

Click to download the PDB-style file with coordinates for d5zc7b_.
(The format of our PDB-style files is described here.)

Timeline for d5zc7b_:

  • d5zc7b_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21