Lineage for d6mjsb_ (6mjs B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2366404Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2366482Protein Azurin [49530] (6 species)
  7. 2366513Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 3065159Domain d6mjsb_: 6mjs B: [365221]
    Other proteins in same PDB: d6mjsa2
    automated match to d4k9ja_
    complexed with cu, req

Details for d6mjsb_

PDB Entry: 6mjs (more details), 1.85 Å

PDB Description: azurin 122w/124w/126re
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d6mjsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjsb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvvtd
gmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsalmw
gwlhlk

SCOPe Domain Coordinates for d6mjsb_:

Click to download the PDB-style file with coordinates for d6mjsb_.
(The format of our PDB-style files is described here.)

Timeline for d6mjsb_:

  • d6mjsb_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21