Lineage for d5uf4b_ (5uf4 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435399Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (13 PDB entries)
  8. 3065149Domain d5uf4b_: 5uf4 B: [365211]
    automated match to d3e6ja_
    complexed with gal, glc, nag

Details for d5uf4b_

PDB Entry: 5uf4 (more details), 2.04 Å

PDB Description: crystal structure of variable lymphocyte receptor (vlr) o13 with lnnt bound
PDB Compounds: (B:) o13

SCOPe Domain Sequences for d5uf4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uf4b_ c.10.2.0 (B:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscsgttvnckskslasvpagiptttrvlylndnqitklepgvfdrlvnlqtlwln
nnqltslpaglfdsltqltilaldsnqlqalpvgvfgrlvdlqqlylgsnqlsalpsavf
drlvhlkellmccnkltelprgierlthlthlaldqnqlksiphgafdrlsslthaylfg
npwdcecrdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc
p

SCOPe Domain Coordinates for d5uf4b_:

Click to download the PDB-style file with coordinates for d5uf4b_.
(The format of our PDB-style files is described here.)

Timeline for d5uf4b_:

  • d5uf4b_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21