Lineage for d6nupa1 (6nup A:1-105)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (178 species)
    not a true protein
  7. 3065146Species Rickettsia prowazekii [TaxId:272947] [365208] (1 PDB entry)
  8. 3065147Domain d6nupa1: 6nup A:1-105 [365209]
    Other proteins in same PDB: d6nupa2
    automated match to d1fb6a_
    complexed with cit

Details for d6nupa1

PDB Entry: 6nup (more details), 1.6 Å

PDB Description: structure of thioredoxin (trxa) from rickettsia prowazekii str. madrid e.
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d6nupa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nupa1 c.47.1.0 (A:1-105) automated matches {Rickettsia prowazekii [TaxId: 272947]}
mvnnvtdssfknevlesdlpvmvdfwaewcgpckmlipiideiskelqdkvkvlkmnide
npktpseygirsiptimlfkngeqkdtkiglqqknslldwinksi

SCOPe Domain Coordinates for d6nupa1:

Click to download the PDB-style file with coordinates for d6nupa1.
(The format of our PDB-style files is described here.)

Timeline for d6nupa1:

  • d6nupa1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-21

View in 3D
Domains from same chain:
(mouse over for more information)
d6nupa2