Lineage for d2lhm__ (2lhm -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (13 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (164 PDB entries) 
Domain d2lhm__: 2lhm - [36517]
Details for d2lhm__
PDB Entry: 2lhm (more details), 1.8 Å
PDB Description: crystal structures of the apo-and holomutant human lysozymes with an introduced ca2+ binding site
SCOP Domain Sequences for d2lhm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lhm__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallddniaddvacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d2lhm__:
Click to download the PDB-style file with coordinates for d2lhm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2lhm__:
- d2lhm__ appears in SCOP 1.57
- d2lhm__ appears in the current release, SCOPe 2.08, called d2lhma_
View in 3D