Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Azurin [49530] (6 species) |
Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
Domain d6mjrb1: 6mjr B:2-128 [365167] Other proteins in same PDB: d6mjra2, d6mjrb2, d6mjrc2, d6mjrd2 automated match to d4k9ja_ complexed with cu, req |
PDB Entry: 6mjr (more details), 2.01 Å
SCOPe Domain Sequences for d6mjrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mjrb1 b.6.1.1 (B:2-128) Azurin {Pseudomonas aeruginosa [TaxId: 287]} ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvvt dgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsalm wgflhlk
Timeline for d6mjrb1: