SCOPe 2.08: Domain d6mjrb1: 6mjr B:2-128

Lineage for d6mjrb1 (6mjr B:2-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d6mjrb1: 6mjr B:2-128 [365167]
   Other proteins in same PDB: d6mjra2, d6mjrb2, d6mjrc2, d6mjrd2
   automated match to d4k9ja_
   complexed with cu, req

Details for d6mjrb1

PDB Entry: 6mjr, 2.01 Å

PDB Description: azurin 122w/124f/126re

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d6mjrb1:

Sequence; same for both SEQRES and ATOM records:

>d6mjrb1 b.6.1.1 (B:2-128) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvvt
dgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsalm
wgflhlk

Timeline for d6mjrb1:

• d6mjrb1 first appeared in SCOPe 2.07