SCOP 1.65: Domain d1wqp__: 1wqp -

Lineage for d1wqp__ (1wqp -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tussues ans secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries)

8. Domain d1wqp__: 1wqp - [36513]
   complexed with cl, na; mutant

Details for d1wqp__

PDB Entry: 1wqp, 1.8 Å

PDB Description: contribution of hydrogen bonds to the conformational stability of human lysozyme

SCOP Domain Sequences for d1wqp__:

Sequence; same for both SEQRES and ATOM records:

>d1wqp__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnfnagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1wqp__:

• d1wqp__ first appeared (with stable ids) in SCOP 1.55
  
• d1wqp__ appears in SCOP 1.63
  
• d1wqp__ appears in SCOP 1.67
  
• d1wqp__ appears in the current release, SCOPe 2.08, called d1wqpa_