Lineage for d6iemd_ (6iem D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (25 species)
    not a true protein
  7. 2337479Species Mycobacterium tuberculosis [TaxId:83332] [225923] (9 PDB entries)
  8. 3065064Domain d6iemd_: 6iem D: [365126]
    automated match to d1tj7a_
    complexed with 2pe, edo, gol, p3g, pg4, pge

Details for d6iemd_

PDB Entry: 6iem (more details), 2.2 Å

PDB Description: argininosuccinate lyase from mycobacterium tuberculosis
PDB Compounds: (D:) Argininosuccinate Lyase

SCOPe Domain Sequences for d6iemd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iemd_ a.127.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
psdalaalsksthfdwvlapydltasrahtmvlfragllteeqrdgllagldslaqdvad
gsfgplvtdedvhaalerglidrvgpdlggrlragrsrndqvaalfrmwlrdavrrvatg
vldvvgalaeqaaahpsaimpgkthlqsaqpillahhllahahpllrdldrivdfdkraa
vspygsgalagsslgldpdaiaadlgfsaaadnsvdataardfaaeaafvfamiavdlsr
laediivwsstefgyvtlhdswstgssimpqkknpdiaelargksgrlignlagllatlk
aqplaynrdlqedkepvfdsvaqlelllpamaglvasltfnvqrmaelapagytlatdla
ewlvrqgvpfrsaheaagaavraaeqrgvglqeltddelaaispeltpqvrevltiegsv
sardcrggtapgrvaeqlnaigeaaerlrrqlvr

SCOPe Domain Coordinates for d6iemd_:

Click to download the PDB-style file with coordinates for d6iemd_.
(The format of our PDB-style files is described here.)

Timeline for d6iemd_:

  • d6iemd_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21