Lineage for d6iw3a_ (6iw3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (88 PDB entries)
  8. 3065060Domain d6iw3a_: 6iw3 A: [365122]
    automated match to d4wipc_
    mutant

Details for d6iw3a_

PDB Entry: 6iw3 (more details), 1.64 Å

PDB Description: high resolution structure of dvl2-dix y27w/c80s mutant
PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d6iw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iw3a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
getkviyhldeeetpwlvkipvpaeritlgdfksvlqrpagakyffksmdqdfgvvkeei
sddnarlpsfngrvvswlvss

SCOPe Domain Coordinates for d6iw3a_:

Click to download the PDB-style file with coordinates for d6iw3a_.
(The format of our PDB-style files is described here.)

Timeline for d6iw3a_:

  • d6iw3a_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21