SCOPe 2.08: Domain d6h8ma_: 6h8m A:

Lineage for d6h8ma_ (6h8m A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.170: SRCR-like [56486] (2 superfamilies)
   unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta

4. Superfamily d.170.1: SRCR-like [56487] (3 families)

5. Family d.170.1.0: automated matches [331628] (1 protein)
   not a true family

6. Protein automated matches [331629] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [346392] (5 PDB entries)

8. Domain d6h8ma_: 6h8m A: [365081]
   automated match to d1by2a_

Details for d6h8ma_

PDB Entry: 6h8m, 1.7 Å

PDB Description: crystal structure of the third srcr domain of murine neurotrypsin.

PDB Compounds: (A:) Neurotrypsin

SCOPe Domain Sequences for d6h8ma_:

Sequence; same for both SEQRES and ATOM records:

>d6h8ma_ d.170.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gfpirlvdgenkkegrvevfvngqwgticddgwtdkhaavicrqlgykgparartmayfg
egkgpihmdnvkctgnekaladcvkqdigrhncrhsedagvicdyle

Timeline for d6h8ma_:

• d6h8ma_ first appeared in SCOPe 2.07