Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Piper methysticum [TaxId:130404] [350817] (3 PDB entries) |
Domain d6co0d2: 6co0 D:237-391 [365077] automated match to d3wd8a2 complexed with wca |
PDB Entry: 6co0 (more details), 2.7 Å
SCOPe Domain Sequences for d6co0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6co0d2 c.95.1.0 (D:237-391) automated matches {Piper methysticum [TaxId: 130404]} lfqivsgaqtilpdsegainghlrevgltirllkdvpglvsmniekclmeafapmgihdw nsifwiahpggptildqveaklglkeeklkstravlreygnmssacvlfildevrkrsme egktttgegfdwgvlfgfgpgftvetvvlhsmpip
Timeline for d6co0d2: