SCOPe 2.05: Domain d134la_: 134l A:

Lineage for d134la_ (134l A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (201 PDB entries)
   Uniprot P00695

8. Domain d134la_: 134l A: [36505]
   mutant

Details for d134la_

PDB Entry: 134l, 1.77 Å

PDB Description: role of arg 115 in the catalytic action of human lysozyme. x-ray structure of his 115 and glu 115 mutants

PDB Compounds: (A:) human lysozyme

SCOPe Domain Sequences for d134la_:

Sequence; same for both SEQRES and ATOM records:

>d134la_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnecqnrd
vrqyvqgcgv

Timeline for d134la_:

• d134la_ first appeared (with stable ids) in SCOP 1.55, called d134l__
  
• d134la_ appears in SCOPe 2.04
  
• d134la_ appears in SCOPe 2.06
  
• d134la_ appears in the current release, SCOPe 2.08