Lineage for d6b6ja1 (6b6j A:1-132)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) 
alpha-beta(2)-alpha-beta(5)-alphaFamily d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
automatically mapped to Pfam PF00235Protein automated matches [190412] (11 species)
not a true proteinSpecies Artemisia vulgaris [TaxId:4220] [318111] (2 PDB entries) 
Domain d6b6ja1: 6b6j A:1-132 [365006]
Other proteins in same PDB: d6b6ja2
automated match to d5nzba_
Details for d6b6ja1
PDB Entry: 6b6j (more details), 1.9 Å
PDB Description: structure of profilin art v4
PDB Compounds: (A:) Profilin-1SCOPe Domain Sequences for d6b6ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b6ja1 d.110.1.1 (A:1-132) automated matches {Artemisia vulgaris [TaxId: 4220]}
swqtyvddhlmcdiegtgqhltsaaifgtdgtvwaksasfpefkpneidaiikefneagq
laptglflggakymviqgeagavirgkkgaggicikktgqamvfgiydepvapgqcnmvv
erlgdylldqgm
SCOPe Domain Coordinates for d6b6ja1:
Click to download the PDB-style file with coordinates for d6b6ja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6b6ja1:
- d6b6ja1 first appeared in SCOPe 2.07
View in 3D
