Lineage for d6a50b1 (6a50 B:2-181)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446486Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2446487Protein automated matches [227126] (21 species)
    not a true protein
  7. 2446681Species Pseudomonas putida [TaxId:303] [254984] (36 PDB entries)
  8. 3064936Domain d6a50b1: 6a50 B:2-181 [364998]
    Other proteins in same PDB: d6a50a2, d6a50a4, d6a50b2, d6a50b4
    automated match to d2fwna2
    complexed with mg, tpp

Details for d6a50b1

PDB Entry: 6a50 (more details), 1.8 Å

PDB Description: structure of benzoylformate decarboxylases in complex with cofactor tpp
PDB Compounds: (B:) benzoylformate decarboxylases

SCOPe Domain Sequences for d6a50b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a50b1 c.36.1.0 (B:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnartshsplivtagqqtramigveagetnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d6a50b1:

Click to download the PDB-style file with coordinates for d6a50b1.
(The format of our PDB-style files is described here.)

Timeline for d6a50b1:

  • d6a50b1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-21