SCOPe 2.07: Domain d6i8si2: 6i8s I:107-211

Lineage for d6i8si2 (6i8s I:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [224854] (2 PDB entries)

8. Domain d6i8si2: 6i8s I:107-211 [364987]
   Other proteins in same PDB: d6i8sa_, d6i8sb_, d6i8sc_, d6i8sd_, d6i8si1, d6i8sj1, d6i8sk1, d6i8sl1
   automated match to d1dn0a2

Details for d6i8si2

PDB Entry: 6i8s, 2.9 Å

PDB Description: discovery and characterisation of an antibody that selectively modulates the inhibitory activity of plasminogen activator inhibitor- 1

PDB Compounds: (I:) light chain of fab fragment from an pai-1 antibody

SCOPe Domain Sequences for d6i8si2:

Sequence; same for both SEQRES and ATOM records:

>d6i8si2 b.1.1.2 (I:107-211) automated matches {Escherichia coli [TaxId: 562]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d6i8si2:

• d6i8si2 is new in SCOPe 2.07-stable
  
• d6i8si2 appears in the current release, SCOPe 2.08