SCOPe 2.08: Domain d2bqia_: 2bqi A:

Lineage for d2bqia_ (2bqi A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (15 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
   Uniprot P00695

8. Domain d2bqia_: 2bqi A: [36498]

Details for d2bqia_

PDB Entry: 2bqi, 1.8 Å

PDB Description: contribution of hydrophobic effect to the conformational stability of human lysozyme

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2bqia_:

Sequence; same for both SEQRES and ATOM records:

>d2bqia_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
arqyvqgcgv

Timeline for d2bqia_:

• d2bqia_ first appeared (with stable ids) in SCOP 1.55, called d2bqi__
  
• d2bqia_ appears in SCOPe 2.07