Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
Domain d5z23f_: 5z23 F: [364954] Other proteins in same PDB: d5z23c_, d5z23d_, d5z23g_, d5z23h_ automated match to d1kx5b_ protein/DNA complex |
PDB Entry: 5z23 (more details), 2.73 Å
SCOPe Domain Sequences for d5z23f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z23f_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]} rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr ktvtamdvvyalkrqgrtlygfgg
Timeline for d5z23f_: