Lineage for d5zbxc_ (5zbx C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2310745Protein automated matches [193445] (6 species)
    not a true protein
  7. 2310800Species Human (Homo sapiens) [TaxId:9606] [193446] (51 PDB entries)
  8. 3064891Domain d5zbxc_: 5zbx C: [364953]
    Other proteins in same PDB: d5zbxb_, d5zbxf_
    automated match to d1m1ac_
    protein/DNA complex; complexed with cl, mn

Details for d5zbxc_

PDB Entry: 5zbx (more details), 2.58 Å

PDB Description: the crystal structure of the nucleosome containing histone h3.1 catd(v76q, k77d)
PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d5zbxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zbxc_ a.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaa
rdnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d5zbxc_:

Click to download the PDB-style file with coordinates for d5zbxc_.
(The format of our PDB-style files is described here.)

Timeline for d5zbxc_:

  • d5zbxc_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-14