Lineage for d5zb5b_ (5zb5 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566683Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2566684Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2566697Family d.305.1.0: automated matches [196445] (1 protein)
    not a true family
  6. 2566698Protein automated matches [196446] (6 species)
    not a true protein
  7. 3064888Species Pneumocystis carinii [TaxId:4754] [364950] (1 PDB entry)
  8. 3064889Domain d5zb5b_: 5zb5 B: [364951]
    automated match to d5gpla_
    complexed with gol, peg

Details for d5zb5b_

PDB Entry: 5zb5 (more details), 2.3 Å

PDB Description: the structural basis of histone chaperonevps75
PDB Compounds: (B:) NAP family histone chaperone vps75

SCOPe Domain Sequences for d5zb5b_:

Sequence, based on SEQRES records: (download)

>d5zb5b_ d.305.1.0 (B:) automated matches {Pneumocystis carinii [TaxId: 4754]}
ttsldevadielefekadvellkhqvelfnplyekranvlrkipkfwpiaieaapsdels
vyispedanvlehlidlrvyrpnedprdikivfefeaneylesnslyleklfryssqkae
asssninkepsqlisekvniewkknkdltrqtkgtapsfftwfswtgkendifedeeela
ifiaedlypnavkyftdal

Sequence, based on observed residues (ATOM records): (download)

>d5zb5b_ d.305.1.0 (B:) automated matches {Pneumocystis carinii [TaxId: 4754]}
ttsldevadielefekadvellkhqvelfnplyekranvlrkipkfwpiaieaapsdels
vyispedanvlehlidlrvyrpnedprdikivfefeaneylesnslyleklfryssqkae
ankepsqlisekvniewkknkdltrapsfftwfswtgkendifedeeelaifiaedlypn
avkyftdal

SCOPe Domain Coordinates for d5zb5b_:

Click to download the PDB-style file with coordinates for d5zb5b_.
(The format of our PDB-style files is described here.)

Timeline for d5zb5b_:

  • d5zb5b_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-14