Lineage for d2bqj__ (2bqj -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (16 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (183 PDB entries) 
Domain d2bqj__: 2bqj - [36495]
Details for d2bqj__
PDB Entry: 2bqj (more details), 1.8 Å
PDB Description: contribution of hydrophobic effect to the conformational stability of human lysozyme
SCOP Domain Sequences for d2bqj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bqj__ d.2.1.2 (-) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
vrqyaqgcgv
SCOP Domain Coordinates for d2bqj__:
Click to download the PDB-style file with coordinates for d2bqj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bqj__:
- d2bqj__ first appeared (with stable ids) in SCOP 1.55
- d2bqj__ appears in SCOP 1.59
- d2bqj__ appears in SCOP 1.63
- d2bqj__ appears in the current release, SCOPe 2.08, called d2bqja_
View in 3D