Lineage for d6np7a_ (6np7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (13 species)
    not a true protein
  7. 3064212Species Trypanosoma cruzi [TaxId:5693] [364274] (2 PDB entries)
  8. 3064885Domain d6np7a_: 6np7 A: [364947]
    automated match to d5c4qa_

Details for d6np7a_

PDB Entry: 6np7 (more details), 2.16 Å

PDB Description: crystal structure of trypanosoma cruzi bromodomain bdf2 (tcclb.506553.20)
PDB Compounds: (A:) Bromodomain factor 2 protein

SCOPe Domain Sequences for d6np7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6np7a_ a.29.2.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
gtldkarclafvhqlwdkdklkmfhhpisaaelpdyhkvinypvdlstirqgiesgkyds
dadvqnavaqmianaleynakgtewhqqalsfrsiyldvarqcglsvdddaay

SCOPe Domain Coordinates for d6np7a_:

Click to download the PDB-style file with coordinates for d6np7a_.
(The format of our PDB-style files is described here.)

Timeline for d6np7a_:

  • d6np7a_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-14

View in 3D
Domains from other chains:
(mouse over for more information)
d6np7b_