Lineage for d1gb9a_ (1gb9 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 129072Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 129073Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 129082Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 129130Protein Lysozyme [53961] (15 species)
  7. 129322Species Human (Homo sapiens) [TaxId:9606] [53969] (181 PDB entries)
  8. 129410Domain d1gb9a_: 1gb9 A: [36494]

Details for d1gb9a_

PDB Entry: 1gb9 (more details), 1.8 Å

PDB Description: crystal structure of mutant human lysozyme substituted at the surface positions

SCOP Domain Sequences for d1gb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gb9a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgafnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOP Domain Coordinates for d1gb9a_:

Click to download the PDB-style file with coordinates for d1gb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1gb9a_: