Lineage for d6mdba1 (6mdb A:3-110)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (69 PDB entries)
  8. 3064874Domain d6mdba1: 6mdb A:3-110 [364936]
    Other proteins in same PDB: d6mdba3, d6mdbb3
    automated match to d2shpa2
    complexed with je4, po4

Details for d6mdba1

PDB Entry: 6mdb (more details), 2.34 Å

PDB Description: non-receptor protein tyrosine phosphatase shp2 in complex with allosteric inhibitor pyrazolo-pyrimidinone 5
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d6mdba1:

Sequence, based on SEQRES records: (download)

>d6mdba1 d.93.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Sequence, based on observed residues (ATOM records): (download)

>d6mdba1 d.93.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkgdvielkyplncadptse

SCOPe Domain Coordinates for d6mdba1:

Click to download the PDB-style file with coordinates for d6mdba1.
(The format of our PDB-style files is described here.)

Timeline for d6mdba1:

  • d6mdba1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14