Lineage for d6iccl2 (6icc L:130-233)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761349Domain d6iccl2: 6icc L:130-233 [364932]
    Other proteins in same PDB: d6icch_
    automated match to d2fb4l2

Details for d6iccl2

PDB Entry: 6icc (more details), 2 Å

PDB Description: the nz-1 fab complexed with the pdz tandem fragment of a. aeolicus s2p homolog with the pa12 tag inserted between the residues 181 and 186
PDB Compounds: (L:) Light chain of antigen binding fragment, Fab of NZ-1

SCOPe Domain Sequences for d6iccl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iccl2 b.1.1.0 (L:130-233) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qpkstptltvfppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkq
gnkyiassflrltaeqwrsrnsftcqvthegntvekslspaecv

SCOPe Domain Coordinates for d6iccl2:

Click to download the PDB-style file with coordinates for d6iccl2.
(The format of our PDB-style files is described here.)

Timeline for d6iccl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iccl1
View in 3D
Domains from other chains:
(mouse over for more information)
d6icch_