Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries) |
Domain d6iccl2: 6icc L:130-233 [364932] Other proteins in same PDB: d6icch_ automated match to d2fb4l2 |
PDB Entry: 6icc (more details), 2 Å
SCOPe Domain Sequences for d6iccl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iccl2 b.1.1.0 (L:130-233) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} qpkstptltvfppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkq gnkyiassflrltaeqwrsrnsftcqvthegntvekslspaecv
Timeline for d6iccl2: