Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Yellow fever virus (strain 17d vaccine) [TaxId:11090] [364871] (3 PDB entries) |
Domain d6iw2j1: 6iw2 J:1-295 [364910] Other proteins in same PDB: d6iw2a2, d6iw2b_, d6iw2c_, d6iw2d2, d6iw2e_, d6iw2f_, d6iw2g2, d6iw2h_, d6iw2i_, d6iw2j2, d6iw2k_, d6iw2l_, d6iw2m2, d6iw2n_, d6iw2o_, d6iw2p2, d6iw2q_, d6iw2r_ automated match to d3p54a1 |
PDB Entry: 6iw2 (more details), 2.9 Å
SCOPe Domain Sequences for d6iw2j1:
Sequence, based on SEQRES records: (download)
>d6iw2j1 f.10.1.0 (J:1-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa tirvlalgnqegslktaltgamrvtkdtndnnlyklhgghvscrvklsaltlkgt
>d6iw2j1 f.10.1.0 (J:1-295) automated matches {Yellow fever virus (strain 17d vaccine) [TaxId: 11090]} ahcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldisletvaidrpaevrkvc ynavlthvkindkcpstgeahlaeenegdnackrtysdrgwgngcglfgkgsivacakft caksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqevefigygkatl ecqvqtavdfgnsyiaemeteswivdrqwaqdltlpwqsgsggvwremhhlvefepphaa tirvlalgnqegslktaltgamrvtkdlyklhgghvscrvklsaltlkgt
Timeline for d6iw2j1: