Lineage for d6n4la_ (6n4l A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449617Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2449832Protein Nitrogenase iron protein [52661] (2 species)
  7. 2449833Species Azotobacter vinelandii [TaxId:354] [52662] (25 PDB entries)
  8. 3064843Domain d6n4la_: 6n4l A: [364905]
    automated match to d1fp6a_
    complexed with adp, mg, sf4

Details for d6n4la_

PDB Entry: 6n4l (more details), 1.13 Å

PDB Description: dithionite-reduced adp-bound form of the nitrogenase fe-protein from a. vinelandii
PDB Compounds: (A:) nitrogenase iron protein 1

SCOPe Domain Sequences for d6n4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4la_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivg

SCOPe Domain Coordinates for d6n4la_:

Click to download the PDB-style file with coordinates for d6n4la_.
(The format of our PDB-style files is described here.)

Timeline for d6n4la_:

  • d6n4la_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-14