Lineage for d6ec6a2 (6ec6 A:186-278)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2359630Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2360089Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2360090Protein automated matches [254633] (12 species)
    not a true protein
  7. 3061185Species Ruminococcus gnavus [TaxId:33038] [361247] (2 PDB entries)
  8. 3064833Domain d6ec6a2: 6ec6 A:186-278 [364895]
    Other proteins in same PDB: d6ec6a1, d6ec6a3, d6ec6b1, d6ec6b3
    automated match to d5c71a2
    complexed with cl, gol

Details for d6ec6a2

PDB Entry: 6ec6 (more details), 2.85 Å

PDB Description: ruminococcus gnavus beta-glucuronidase
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d6ec6a2:

Sequence, based on SEQRES records: (download)

>d6ec6a2 b.1.4.0 (A:186-278) automated matches {Ruminococcus gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanahl
wevrnaylyqivilitdgngvldeyrekigirt

Sequence, based on observed residues (ATOM records): (download)

>d6ec6a2 b.1.4.0 (A:186-278) automated matches {Ruminococcus gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanahl
wevrnaylyqivilitdvldeyrekigirt

SCOPe Domain Coordinates for d6ec6a2:

Click to download the PDB-style file with coordinates for d6ec6a2.
(The format of our PDB-style files is described here.)

Timeline for d6ec6a2:

  • d6ec6a2 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14