Lineage for d6i8sl1 (6i8s L:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355342Species Escherichia coli [TaxId:562] [224856] (2 PDB entries)
  8. 3064828Domain d6i8sl1: 6i8s L:1-106 [364890]
    Other proteins in same PDB: d6i8sa_, d6i8sb_, d6i8sc_, d6i8sd_, d6i8si2, d6i8sj2, d6i8sk2, d6i8sl2
    automated match to d1dn0a1

Details for d6i8sl1

PDB Entry: 6i8s (more details), 2.9 Å

PDB Description: discovery and characterisation of an antibody that selectively modulates the inhibitory activity of plasminogen activator inhibitor- 1
PDB Compounds: (L:) light chain of fab fragment from an pai-1 antibody

SCOPe Domain Sequences for d6i8sl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i8sl1 b.1.1.0 (L:1-106) automated matches {Escherichia coli [TaxId: 562]}
diqmtqspstlsasvgdrvtitcrasegiyhnlawyqqkpgkapklliykasslasgvps
rfsgsrsgteftltisslqpddfatyycqqysnypltfgggtkvei

SCOPe Domain Coordinates for d6i8sl1:

Click to download the PDB-style file with coordinates for d6i8sl1.
(The format of our PDB-style files is described here.)

Timeline for d6i8sl1:

  • d6i8sl1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14