Lineage for d6dgfa_ (6dgf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497848Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2497901Protein automated matches [191167] (1 species)
    not a true protein
  7. 2497902Species Human (Homo sapiens) [TaxId:9606] [189384] (6 PDB entries)
  8. 3064797Domain d6dgfa_: 6dgf A: [364859]
    Other proteins in same PDB: d6dgfb1, d6dgfb2
    automated match to d3nhea_
    complexed with so4, zn

Details for d6dgfa_

PDB Entry: 6dgf (more details), 2.34 Å

PDB Description: ubiquitin variant bound to usp2
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d6dgfa_:

Sequence, based on SEQRES records: (download)

>d6dgfa_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks
npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls
lpiakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhl
krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc
rspgtgewhtfndssvtpmsssqvrtsdayllfyelasppsrm

Sequence, based on observed residues (ATOM records): (download)

>d6dgfa_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvdhlpdd
ekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslpiakypevtl
mdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfsesrirtskl
ttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewhtfnd
ssvtpmsssqvrtsdayllfyelasppsrm

SCOPe Domain Coordinates for d6dgfa_:

Click to download the PDB-style file with coordinates for d6dgfa_.
(The format of our PDB-style files is described here.)

Timeline for d6dgfa_:

  • d6dgfa_ is new in SCOPe 2.07-stable