Lineage for d6ivza1 (6ivz A:2-295)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (10 species)
    not a true protein
  7. 3059469Species Yellow fever virus [TaxId:11089] [359531] (3 PDB entries)
  8. 3064795Domain d6ivza1: 6ivz A:2-295 [364857]
    Other proteins in same PDB: d6ivza2, d6ivzh_, d6ivzl_
    automated match to d3p54a1

Details for d6ivza1

PDB Entry: 6ivz (more details), 2.4 Å

PDB Description: crystal structure of 5a scfv complexed with yfv-china se in postfusion state
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d6ivza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ivza1 f.10.1.0 (A:2-295) automated matches {Yellow fever virus [TaxId: 11089]}
hcigitdrdfiegvhggtwvsatleqdkcvtvmapdkpsldislqtvaidgpaearkvcy
savlthvkindkcpstgeahlaeendgdnackrtysdrgwgngcglfgkgsivacakftc
aksmslfevdqtkiqyviraqlhvgakqenwntdiktlkfdalsgsqeaeftgygkatle
cqvqtavdfgnsyiaemekdswivdrqwaqdltlpwqsgsggiwremhhlvefepphaat
irvlalgnqegslktaltgamrvtkdendnnlyklhgghvscrvklsaltlkgt

SCOPe Domain Coordinates for d6ivza1:

Click to download the PDB-style file with coordinates for d6ivza1.
(The format of our PDB-style files is described here.)

Timeline for d6ivza1:

  • d6ivza1 appears in periodic updates to SCOPe 2.07 starting on 2019-02-14

View in 3D
Domains from same chain:
(mouse over for more information)
d6ivza2